PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM11G14240.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 300aa    MW: 33022.6 Da    PI: 6.7353
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM11G14240.3genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM119.63e-37181481128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      l pGfrF+Ptd+elv +yL +++ + +l++  +i++vdi++++Pwd+   v ++ek  +fF++++ ky+ ++r+nr++ +g+W+a g++ +++ 
  OGLUM11G14240.3  18 LLPGFRFRPTDDELVIKYLYPRAFHVPLPC-AIITDVDIHQHNPWDIV-PVVEREKGKHFFTRKEVKYPGSRRSNRVAGNGFWRAAGSEVPIYY 109
                      579***************************.88**************5.455678999************************************ PP

              NAM  95 k.....kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      k     ++ lvg+++tLvf+ g+++++e+t+W mhe++l
  OGLUM11G14240.3 110 KpegaaDDMLVGMRRTLVFHYGKSRSAERTEWAMHEFQL 148
                      9877776777***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-4012153IPR003441NAC domain
PROSITE profilePS5100538.96918217IPR003441NAC domain
PfamPF023651.4E-1920148IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MANTGLSIPM VNGATIHLLP GFRFRPTDDE LVIKYLYPRA FHVPLPCAII TDVDIHQHNP  60
WDIVPVVERE KGKHFFTRKE VKYPGSRRSN RVAGNGFWRA AGSEVPIYYK PEGAADDMLV  120
GMRRTLVFHY GKSRSAERTE WAMHEFQLAG AGLLPRPMMR RATSNGSEPP CGCLEATIAK  180
KSDGLSATLH AKRDSAPLMR IMVEPDSSWV ICCIYKKRQR APPVVIPPVI GDVGEAIIPH  240
AIGDAREGQL HFIDFLGQPA RNDPSSPHSC TIDPSSLEEG SDESAGDGED KDGDGMNEAN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-281414811140Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1073690.0AK107369.1 Oryza sativa Japonica Group cDNA clone:002-127-B02, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015615934.10.0PREDICTED: NAC transcription factor 25
TrEMBLA0A0E0BJF20.0A0A0E0BJF2_9ORYZ; Uncharacterized protein
STRINGORGLA11G0125600.10.0(Oryza glaberrima)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13180.11e-34NAC domain containing protein 83